RP00336B
Biotinylated Recombinant Human DNAM-1/CD226 Protein
Größe
£657.00
- SKU:
- RP00336B
- Zusätzliche Namen:
- CD226|CD226 molecule|DNAM1|PTA1|TLiSA1
- Molekulargewicht:
- 50-70 kDa
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Glu19-Asn247
- Formulierung:
- Biotinylated Recombinant Human DNAM-1/CD226 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu19-Asn247) of Human DNAM-1/CD226 (Accession #Q15762) fused with a C-His&Avi tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN
- Uniprot:
- Q15762
- Synonyme:
- adhesion glycoprotein;CD226 antigen;DNAM-1;DNAM1;DNAX accessory molecule 1;DNAX accessory molecule-1;platelet and T cell activation antigen 1;PTA1;T lineage-specific activation antigen 1 antigen;TLiSA1
- Weitere Details:
- DNAX accessory molecule-1 (DNAM-1), also known as CD226, is a 65 kDa type I transmembrane glycoprotein in the immunoglobulin superfamily.DNAM-1 mediates cellular adhesion to other cells bearing its ligands, CD112 and CD155, and cross-linking DNAM-1 with antibodies causes cellular activation. Furthermore, DNAM-1 can interact with PVR and PVRL2.
- Versandbedingungen:
- Blue Ice