RP00327
Recombinant Human B7-H1/PD-L1/CD274 Protein
Größe
£353.00
- SKU:
- RP00327
- Zusätzliche Namen:
- B7-H|B7-H1|B7H1|CD274|PD-L1|PD-L1B7 homolog 1|PDCD1L1|PDCD1LG1|PDL1
- Molekulargewicht:
- 35-45 kDa
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Phe19-Ile226
- Formulierung:
- Recombinant Human PD-L1/B7-H1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe19-Ile226) of Human PD-L1/B7-H1 (Accession #Q9NZQ7-1) fused with a C-His tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVI
- Uniprot:
- Q9NZQ7-1
- Synonyme:
- B7 homolog 1;B7-H;B7H1;CD274 antigen;hPD-L1;PD-L1;PDCD1 ligand 1;PDCD1L1;PDCD1LG1;PDL1;programmed cell death 1 ligand 1
- Weitere Details:
- B7-H1, also known as PD-L1 and CD274, is an approximately 65 kDa transmembrane glycoprotein in the B7 family of immune regulatory molecules. PD-L1 has been identified as the ligand for the immunoinhibitory receptor programmed death-1(PD1/PDCD1) and has been demonstrated to play a role in the regulation of immune responses and peripheral tolerance.
- Versandbedingungen:
- Blue Ice