Recombinant Human Fc-gamma RIII beta/FCGR3B/CD16b Protein

Größe

£123.25

War £145.00

SKU:: RP00291
Zusätzliche Namen:: FCGR3B,CD16,CD16b,FCG3,FCGR3,FCR-10,FCRIII,FCRIIIb
Molekulargewicht:: 40-55 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Thr20-Gln208
Formulierung:: Recombinant Human Fc-gamma RIII beta/FCGR3B/CD16b Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr20-Gln208) of human Fc gamma RIIIB/CD16b (Accession #NP_000561.3) fused with a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: TEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQ
Uniprot:: O75015
Synonyme:: CD16;CD16A;CD16b;Fc fragment of IgG, low affinity IIIb, receptor (CD16b);Fc gamma receptor III-B;Fc gamma receptor IIIb;Fc-gamma receptor IIIb (CD 16);fc-gamma RIII-beta;fc-gamma RIIIb;FCG3;FCGR3;FCGR3A;FCR-10;FCRIII;FCRIIIb;igG Fc receptor III-1;low affinity immunoglobulin gamma Fc region receptor III-B
Weitere Details:: CD16 is a low affinity Fc receptor, and has been identified as Fc receptors FcG GammaRIIIa (CD16a) and FcG GammaRIIIb (CD16b). These receptors function in the activation or inhibition of immune responses. CD16 encoded by two different highly homologous genes in a cell type-specific manner.CD16 is found on the surface of natural killer cells, neutrophil polymorphonuclear leukocytes, monocytes and macrophages. CD16B is also kown as FCGR3B and FCG3B, is expressed specifically by polymorphonuclear leukocytes (neutrophils) and stimulated eosinophils. CD16B is the low affinity receptor for the Fc region of immunoglobulins gamma. CD16B may serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.

Versandbedingungen:: Blue Ice