Recombinant Human Retinol-binding protein 4/PRBP Protein

Größe

£133.00

SKU:: RP00284
Zusätzliche Namen:: MCOPCB10, RDCCAS,RBP4,RDCCAS
Molekulargewicht:: 55 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Glu19-Leu201
Formulierung:: Recombinant Human Retinol-binding protein 4/PRBP Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Glu19-Leu201) of human RBP4 (Accession #NP_006735.2) fused with an Fc, 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Uniprot:: P02753
Synonyme:: MCOPCB10;plasma retinol-binding protein;PRBP;RBP;RDCCAS;retinol binding protein 4, plasma;retinol-binding protein 4;retinol-binding protein 4, interstitial
Weitere Details:: This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin which prevents its loss by filtration through the kidney glomeruli. A deficiency of vitamin A blocks secretion of the binding protein posttranslationally and results in defective delivery and supply to the epidermal cells.