Recombinant Human THSD1 Protein

Größe

£115.00

SKU:: RP00253
Zusätzliche Namen:: THSD1
Molekulargewicht:: 55-70 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Glu25-Ile361
Formulierung:: Recombinant Human THSD1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu 25 - Ile 361 ) of human THSD1 (Accession #NP_954872.1) fused with a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: EYLLLREPGHVALSNDTVYVDFQYFDGANGTLRNVSVLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATDNSTPFPWWEKSAFLKVEWPVFHVDLNRSAKAAEGTFQVGLFTSQPLCPFPVDKPNIVVDVIFTNSLPEARRNSRQPLEIRTSKRTELAQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVMVPELTCESGVEVTVLPPPCTFVQGVVTVFKEAPRYPGKRTIHLAENSLPLGERRTIFNCTLFDMGKNKYCFDFGISSRSHFSAKEECMLIQRNTAFQPSSPSPLQPQGPVKSNNI
Uniprot:: Q9NS62-2
Synonyme:: 4833423O18Rik;ANIB12;thrombospondin type-1 domain-containing protein 1;thrombospondin, type I, domain containing 1;TMTSP;transmembrane molecule with thrombospondin module;UNQ3010
Weitere Details:: Human Thrombospondin type-1 domain-containing protein 1 (THSD1) also known as Transmembrane molecule with thrombospondin module (TMTSP), is a single-pass type I membrane protein. In addition, THSD1 is widely expressed on endothelial cells, with highest expression in the lung. THSD1's ligand and function are unknown, but it is postulated that THSD1 may be involved in the regulation of vasculogenesis and/or angiogenesis through its interaction with its specific ligand.

Versandbedingungen:: Blue Ice