RP00251
Recombinant Human Growth hormone receptor/GHR Protein
Größe
£353.00
- SKU:
- RP00251
- Zusätzliche Namen:
- GHR,GHBP,GHIP
- Molekulargewicht:
- 70-85 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ala27-Tyr264
- Formulierung:
- Recombinant Human Growth hormone receptor/GHR Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ala 27 - Tyr 264 ) of human Growth Hormone Receptor (GHR) (Accession #NP_000154.1) fused with an Fc, 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- AILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMSQFTCEEDFY
- Uniprot:
- P10912
- Synonyme:
- GH receptor;GHBP;GHIP;growth hormone binding protein;growth hormone receptor;mutant growth hormone receptor;serum binding protein;somatotropin receptor;truncated growth hormone receptor
- Versandbedingungen:
- Blue Ice