RP00247
Recombinant Human Arginase 1/ARG1 Protein
Größe
£193.00
- SKU:
- RP00247
- Zusätzliche Namen:
- ARG1, arginase-1,arginase-1
- Molekulargewicht:
- 40 kDa
- Reinheit:
- ≥90%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Met1-Lys322
- Formulierung:
- Recombinant Human Arginase 1/ARG1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Met 1 - Lys 322 ) of human Arginase (Accession #NP_000036.2) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
- Uniprot:
- P05089-1
- Synonyme:
- arginase-1;arginase, liver;liver-type arginase;type I arginase
- Weitere Details:
- Arg1 also known as liver arginase, is a binuclear manganese metalloenzyme. It is a key enzyme of the urea cycle that catalyses the conversion of L-arginine into L-ornithine and urea, the final cytosolic reaction of urea formation in the mammalian liver. Arginase 1 is abundantly expressed in liver, but it is also expressed in cells and tissues that lack a complete urea cycle, including lung. Arginase is a critical regulator of nitric oxide synthesis and vascular function. It is implicated in a variety of human diseases including vascular disease, pulmonary disease, infectious disease, immune cell function and cancer. In humans, hereditary defects in arginase result in an accumulation of arginine in the blood known as hyperarginemia. Arginase deficiency can also result in the accumulation of nitrogen in the form of ammonia, which results in hyperammonemia.
- Versandbedingungen:
- Blue Ice