Recombinant Human Lumican/LUM Protein

Größe

£127.00

SKU:: RP00216
Zusätzliche Namen:: LDC, SLRR2D,LUM,SLRR2D,lumican
Molekulargewicht:: 45-60 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Gln19-Asn338
Formulierung:: Recombinant Human Lumican/LUM Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln19-Asn338) of human Lumican/LUM (Accession #NP_002336.1) fused with a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: QYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN
Uniprot:: P51884
Synonyme:: epididymis secretory sperm binding protein;keratan sulfate proteoglycan lumican;KSPG lumican;LDC;lumican;lumican proteoglycan;SLRR2D
Weitere Details:: Lumican is a member of the family of small leucine-rich repeat proteoglycans (SLRPs) and the class II subfamily .which is a major component of the cornea, dermal, and muscle connective tissues. Lumican is the major keratan sulfate proteoglycan of the cornea but is also distributed in interstitial collagenous matrices throughout the body. Lumican regulates collagenous matrix assembly as a keratan sulfate proteoglycan in the cornea and is also present in the connective tissues of other organs and embryonic corneal stroma as a glycoprotein. Lumican may regulate collagen fibril organization and circumferential growth, corneal transparency, and epithelial cell migration and tissue repair. Lumican's over-expression has been reported in carcinoid tumor, breast, colorectal, neuroendocrine, uterine cervical and pancreatic cancers

Versandbedingungen:: Blue Ice