Recombinant Human Cathepsin D Protein

Größe

£163.00

SKU:: RP00214
Zusätzliche Namen:: CLN10,CPSD,HEL-S-130P,Cathepsin D,CTSD
Molekulargewicht:: 40-55 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Leu21-Leu412
Formulierung:: Recombinant Human Cathepsin D Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu21-Leu412) of human Cathepsin D/CTSD (Accession #NP_001900.1) fused with a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
Uniprot:: P07339
Synonyme:: cathepsin D;ceroid-lipofuscinosis, neuronal 10;CLN10;CPSD;epididymis secretory sperm binding protein Li 130P;HEL-S-130P;lysosomal aspartyl peptidase;lysosomal aspartyl protease
Weitere Details:: Cathepsin D (CTSD), a well known lysosomal aspartyl protease and belongs to the peptidase C1 family. It is expressed in most cells and overexpressed in breast cancer cells. It is a major enzyme in protein degradation in lysosomes, and also involved in the presentation of antigenic peptides. cathepsin D is essential for proteolysis of proteins regulating cell growth and tissue homeostasis. CTSD secreted from human prostate carcinoma cells are responsible for the generation of angiostatin, a potent endogenous inhibitor of angiogenesis, suggesting its contribution to the prevention of tumor growth and angiogenesis-dependent growth of metastases.

Versandbedingungen:: Blue Ice