RP00207
Recombinant Human CD301 Protein
Größe
£127.00
- SKU:
- RP00207
- Zusätzliche Namen:
- CLEC10A,CD301,CLECSF13,CLECSF14,HML,HML2,MGL
- Molekulargewicht:
- Approximately 40 kDa
- Reinheit:
- ≥90%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Gln61-His316
- Formulierung:
- Recombinant Human CD301 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln61-His316) of human CLEC10A/MGL1/CD301 (Accession #NP_878910.1) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- QNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH
- Uniprot:
- Q8IUN9
- Synonyme:
- C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 13 (macrophage-derived);C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 14 (macrophage-derived);C-type lectin domain family 10 member A;C-type lectin superfamily member 14;CD301;CLECSF13;CLECSF14;HML;HML2;Macrophage lectin 2;macrophage lectin 2 (calcium dependent);MGL
- Weitere Details:
- CLEC10A, also known as macrophage galactose/N-acetyl-galactosamine (GalNAc) specific lectin (MGL), CD301, DC-ASGPR, and HML, is a 40 kDa type II transmembrane glycoprotein that belongs to the C-type lectin family. C-type lectin family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. CLEC10A is expressed on macrophages and related cells of myeloid origins, particularly immature dendritic cells (DCs). CLEC10A plays a protective role against colitis by effectively inducing IL-10 production by colonic lamina propria macrophages in response to invading commensal bacteria.
- Versandbedingungen:
- Blue Ice