Recombinant Human IL-6 Protein

Größe

£157.00

SKU:: RP00201
Zusätzliche Namen:: IL6,BSF-2,BSF2,CDF,HGF,HSF,IFN-beta-2,IFNB2,IL-6
Molekulargewicht:: 23-30
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Val30-Met212
Formulierung:: Recombinant Human IL-6 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Val30-Met212) of human IL6 (Accession #NP_000591.1) fused with a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Uniprot:: P05231
Synonyme:: B-cell differentiation factor;B-cell stimulatory factor 2;BSF-2;BSF2;CDF;CTL differentiation factor;HGF;HSF;hybridoma growth factor;IFN-beta-2;IFNB2;IL-6;interferon beta-2;interleukin BSF-2;interleukin-6
Weitere Details:: Interleukin-6 (IL-6) is a multifunctional A Alpha-helical cytokine that regulates cell growth and differentiation of various tissues, which is known particularly for its role in the immune response and acute phase reactions. The encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this protein is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis.

Versandbedingungen:: Blue Ice