RP00200
Recombinant Human IFN-gamma R1/CD119 Protein
Größe
£107.00
- SKU:
- RP00200
- Zusätzliche Namen:
- CD119, IFNGR, IMD27A, IMD27B,IFNGR1, CD119, interferon gamma receptor 1,IFNGR,IMD27A,IMD27B
- Molekulargewicht:
- 35-50 kDa
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥95 %
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Met1-Gly245
- Formulierung:
- Recombinant Human IFN-gamma R1/CD119 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Gly245) of human IFNGR1/CD119 (Accession #NP_000407.1) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- MALLFLLPLVMQGVSRAEMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKG
- Uniprot:
- P15260
- Synonyme:
- antiviral protein, type 2;AVP, type 2;CD119;CD119 antigen;CDw119;IFN-gamma receptor 1;IFN-gamma-R-alpha;IFN-gamma-R1;IFNGR;IMD27A;IMD27B;immune interferon receptor 1;interferon gamma receptor 1;Interferon gamma receptor alpha-chain;interferon-gamma receptor alpha chain
- Weitere Details:
- The high-affinity IFN-gamma receptor complex is made up of two type I membrane proteins, IFN-gammaR1 (IFN gamma R alpha ) and IFN-gammaR2 (IFN-gamma R beta ). IFN-gamma R1 is the ligand-binding subunit that is necessary and sufficient for IFN-gamma binding and receptor internalization. IFN-gammaR2 is required for IFN gamma signaling but does not bind IFN-gamma by itself. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.
- Versandbedingungen:
- Blue Ice