Recombinant Human GDNFR-alpha-2/GFRA2 Protein

Größe

£107.00

SKU:: RP00199
Zusätzliche Namen:: GFRA2,GDNFRB,NRTNR-ALPHA,NTNRA,RETL2,TRNR2
Molekulargewicht:: 70-75 kda
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Ser22-Ser441
Formulierung:: Recombinant Human GDNFR-alpha-2/GFRA2 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ser22-Ser441) of human GFRA2/GFRA Alpha2/GDNFRB (Accession #NP_001486.4) fused with a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNS
Uniprot:: O00451
Synonyme:: GDNF family receptor alpha-2;GDNF receptor beta;GDNFR-alpha-2;GDNFR-beta;GDNFRB;GFR-alpha 2;glial cell line derived neurotrophic factor receptor, beta;neurturin receptor alpha;NRTNR-ALPHA;NTNR-alpha;NTNRA;PI-linked cell-surface accessory protein;RET ligand 2;RETL2;TGF-beta-related neurotrophic factor receptor 2;TRN receptor, GPI-anchored;TRNR2
Weitere Details:: Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. The protein encoded by this gene is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This encoded protein acts preferentially as a receptor for NTN compared to its other family member, GDNF family receptor alpha 1. This gene is a candidate gene for RET-associated diseases.

Versandbedingungen:: Blue Ice