Recombinant Human Azurocidin/CAP37/AZU1 Protein

Größe

£127.00

SKU:: RP00196
Zusätzliche Namen:: AZU1,AZAMP,AZU,CAP37,HBP,HUMAZUR,NAZC,hHBP
Molekulargewicht:: 40 kDa
Reinheit:: ≥85%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Ile27-Pro250
Formulierung:: Recombinant Human Azurocidin/CAP37/AZU1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile27-Pro250) of human AZU1/Azurocidin 1/CAP37 (Accession #NP_001691.1) fused with a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGPGP
Uniprot:: P20160
Synonyme:: AZAMP;AZU;azurocidin;CAP37;cationic antimicrobial protein 37;cationic antimicrobial protein CAP37;HBP;heparin-binding protein;hHBP;HUMAZUR;NAZC;neutrophil azurocidin
Weitere Details:: Azurocidin (AZU1), also known as heparin-binding protein (HBP) or cationic antimicrobial protein 37 (CAP37), is an azurophil granule antibiotic protein, with monocyte chemotactic and antibacterial activity. The Azurophil granules, specialized lysosomes of the neutrophil, contain at least 10 proteins implicated in the killing of microorganisms. Azurocidin is a member of the serine protease family that includes Cathepsin G, neutrophil elastase (NE), and proteinase 3 (PR3). Azurocidin has also been identified as a modulator of endothelial permeability. Neutrophils arriving first at sites of inflammation release Azurocidin, which acts in a paracrine fashion on endothelial cells causing the development of intercellular gaps and allowing leukocyte extravasation. These findings imply that Azurocidin may be a reasonable therapeutic target for a variety of inflammatory disease conditions.

Versandbedingungen:: Blue Ice