RP00190
Recombinant Human WIF-1(Q166K) Protein
Größe
£127.00
- SKU:
- RP00190
- Zusätzliche Namen:
- WIF-1,WIF1
- Molekulargewicht:
- 45-55 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Gly29-Trp379(Q166K)
- Formulierung:
- Recombinant Human WIF-1(Q166K) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly29-Trp379(Gln166Lys)) of human WIF-1 (Accession #NP_009122.2) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- GPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHTPSLKKAEERRDPPESNYIW
- Uniprot:
- Q9Y5W5
- Synonyme:
- WIF-1;wnt inhibitory factor 1
- Weitere Details:
- WIF (Wnt Inhibitory Factor) is a secreted protein that binds to Wnt proteins and inhibits their activity. WIF is extracellular signaling molecules that play a role in embryonic development. This protein contains a WNT inhibitory factor (WIF) domain and five epidermal growth factor (EGF)-like domains, and is thought to be involved in mesoderm segmentation.. WIF-1 is implicated as an early event tumor suppressor in cancers of the prostate, breast, lung and bladder. However, WIF-1's role in carcinogenesis may not be that simple since in other cancer types, such as colon adenocarcinoma, WIF facilitates tumorigenesis.
- Versandbedingungen:
- Blue Ice