RP00180
Recombinant Human TNFRSF11B/Osteoprotegerin Protein
Größe
£115.00
- SKU:
- RP00180
- Zusätzliche Namen:
- TNFRSF11B, OCIF, OPG, PDB5, TR1, TNF receptor superfamily member 11b,Osteoprotegerin,OCIF,OPG,PDB5,TR1
- Molekulargewicht:
- 55-65 kDa
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥95 %
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Glu22-Leu401
- Formulierung:
- Recombinant Human TNFRSF11B/Osteoprotegerin Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Glu22-Leu401) of human Osteoprotegerin/TNFRSF11B (Accession #NP_002537.3) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL
- Uniprot:
- O00300
- Synonyme:
- OCIF;OPG;osteoclastogenesis inhibitory factor;osteoprotegerin;PDB5;TR1;tumor necrosis factor receptor superfamily member 11B;tumor necrosis factor receptor superfamily, member 11b
- Weitere Details:
- Osteoprotegerin or TNFRSF11B is a member of the TNF-receptor superfamily. This protein is an osteoblast-secreted decoy receptor that functions as a negative regulator of bone resorption. This protein specifically binds to its ligand, osteoprotegerin ligand, both of which are key extracellular regulators of osteoclast development. Studies of the mouse counterpart also suggest that this protein and its ligand play a role in lymph-node organogenesis and vascular calcification.
- Versandbedingungen:
- Blue Ice