Recombinant Human NKp30/NCR3/CD337 Protein

Größe

£133.00

SKU:: RP00179
Zusätzliche Namen:: NCR3,1C7,CD337,LY117,MALS,NKp30
Molekulargewicht:: 54-60 kda
Reinheit:: ≥ 95 % as determined by SDS-PAGE;≥95 %
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Leu19-Thr138
Formulierung:: Recombinant Human NKp30/NCR3/CD337 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu19-Thr138) of human NCR3/NKp300 (Accession #NP_001138938.1) fused with an Fc, 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGT
Uniprot:: O14931
Synonyme:: 1C7;activating natural killer receptor p30;activating NK-A1 receptor;CD337;LY117;lymphocyte antigen 117;MALS;natural cytotoxicity triggering receptor 3;natural killer cell p30-related protein;NK-p30;NKp30
Weitere Details:: Natural Cytotoxicity Triggering Receptor 3, NCR3, also known as NKp30, or CD337, is a natural cytotoxicity receptor. NKp30 is expressed on both resting and activated NK cells of the CD56dim, CD16+ subset that account for more that 85% of NK cells found in peripheral blood and spleen. NKp30 is absent from the CD56bright, CD16- subset that constitutes the majority of NK cells in lymph node and tonsil, however, its expression is up-regulated in these cells upon IL-2 activation .NKp30 is a member of the immunoglobulin superfamily and one of three existing natural cytotoxicity-triggering receptors. NKp30 is a glycosylated protein and is thought to be selectively expressed in resting and activated natural killer cells. NKp30 is a stimulatory receptor on human NK cells implicated in tumor immunity, and is capable of promoting or terminating dendritic cell maturation. NCR3 may play a role in inflammatory and infectious diseases.

Versandbedingungen:: Blue Ice