RP00174
Recombinant Human Thrombopoietin/THPO Protein
Größe
£163.00
- SKU:
- RP00174
- Zusätzliche Namen:
- THPO,MGDF,MKCSF,ML,MPLLG,THCYT1,TPO
- Molekulargewicht:
- 70-90 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ser22-Gly353
- Formulierung:
- Recombinant Human Thrombopoietin/THPO Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser22-Gly353) of human Thrombopoietin/THPO (Accession #NP_000451.1) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
- Uniprot:
- P40225
- Synonyme:
- c-mpl ligand;megakaryocyte colony-stimulating factor;megakaryocyte growth and development factor;megakaryocyte stimulating factor;MGDF;MKCSF;ML;MPL ligand;MPLLG;myeloproliferative leukemia virus oncogene ligand;prepro-thrombopoietin;THCYT1;thrombopoietin;TPO
- Weitere Details:
- Thrombopoietin (TPO or THPO), also known as myeloproliferative leukemia virus ligand (c-Mpl), is a hematopoietic growth factor belonging to the EPO/TPO family. Megakaryocytopoiesis is the cellular development process that leads to platelet production. TPO is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. TPO is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. Mutations in TPO gene are the cause of thrombocythemia .
- Versandbedingungen:
- Blue Ice