Recombinant Human Junctional adhesion molecule C/JAM-3 (A149P) Protein

Größe

£133.00

SKU:: RP00170
Zusätzliche Namen:: JAM3,JAM-2,JAM-3,JAM-C,JAMC
Molekulargewicht:: 60-70 kDa
Reinheit:: ≥ 95 % as determined by SDS-PAGE;≥95 %
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Val32-Asn241(A149P)
Formulierung:: Recombinant Human Junctional adhesion molecule C/JAM-3 (A149P) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val32-Asn241 (Ala149Pro)) of human JAM3/JAM-C (Accession #NP_116190.3) fused with an Fc, 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: VNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKPVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLN
Uniprot:: Q9BX67
Synonyme:: JAM-2;JAM-3;JAM-C;JAMC;Junctional adhesion molecule 3;junctional adhesion molecule C
Weitere Details:: Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is localized in the tight junctions between high endothelial cells. Unlike other proteins in this family, the this protein is unable to adhere to leukocyte cell lines and only forms weak homotypic interactions. The encoded protein is a member of the junctional adhesion molecule protein family and acts as a receptor for another member of this family. A mutation in an intron of this gene is associated with hemorrhagic destruction of the brain, subependymal calcification, and congenital cataracts. Alternative splicing results in multiple transcript variants.

Versandbedingungen:: Blue Ice