Recombinant Human Cell surface A33 antigen/GPA33 Protein

Größe

£133.00

SKU:: RP00163
Zusätzliche Namen:: A33,GPA33
Molekulargewicht:: 35-40 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Ile22-Val235
Formulierung:: Recombinant Human Cell surface A33 antigen/GPA33 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile22-Val235) of human GPA33/Glycoprotein-A33 (Accession #NP_005805.1) fused with a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: ISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNV
Uniprot:: Q99795
Synonyme:: A33;cell surface A33 antigen;Glycoprotein A33;glycoprotein A33 (transmembrane);transmembrane glycoprotein A33
Weitere Details:: Cell surface A33 antigen, also known as glycoprotein A33, is a single-pass type I membrane protein which is expressed in normal gastrointestinal epithelium and in 95% of colon cancers. GPA33 contains one Ig-like C2-type (immunoglobulin-like) domain and one Ig-like V-type (immunoglobulin-like) domain. The open reading frame encodes a 319-amino acid polypeptide having a putative secretory signal sequence and 3 potential glycosylation sites. The predicted mature protein has a 213-amino acid extracellular region, a single transmembrane domain, and a 62-amino acid intracellular tail. Intracellular traffic and recycling to the cell surface appear to play a major role in GPA33 function and to have an influence on its surface density superseding translational regulation.

Versandbedingungen:: Blue Ice