RP00158
Recombinant Human CD5 Protein

Größe
£133.00
- SKU:
- RP00158
- Zusätzliche Namen:
- CD5, LEU1, T1, CD5 molecule,LEU1,T1
- Molekulargewicht:
- 50 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Arg25-Asn371
- Formulierung:
- Recombinant Human CD5 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg25-Asn371) of human CD5 (Accession #NP_055022.2) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPN
- Uniprot:
- P06127
- Synonyme:
- CD5 antigen (p56-62);epididymis secretory sperm binding protein;LEU1;lymphocyte antigen T1/Leu-1;T-cell surface glycoprotein CD5;T1
- Weitere Details:
- CD5, also known as Leu-1, Ly-1, and T1, is a 67 kDa transmembrane glycoprotein in the scavenger receptor superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation.
- Versandbedingungen:
- Blue Ice

