RP00127
Recombinant Human OX-2/CD200 Protein
Größe
£127.00
- SKU:
- RP00127
- Zusätzliche Namen:
- CD200,MOX1,MOX2,MRC,OX-2
- Molekulargewicht:
- 40-50 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Gln31-Gly232
- Formulierung:
- Recombinant Human OX-2/CD200 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln31-Gly232) of human CD200/OX-2 (Accession #NP_005935.4) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- QVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKG
- Uniprot:
- P41217
- Synonyme:
- antigen identified by monoclonal antibody MRC OX-2;CD200 antigen;MOX1;MOX2;MRC;OX-2;OX-2 membrane glycoprotein
- Weitere Details:
- The protein is a type I membrane glycoprotein containing two extracellular immunoglobulin domains, a transmembrane and a cytoplasmic domain. This gene is expressed by various cell types, including B cells, a subset of T cells, thymocytes, endothelial cells, and neurons. The encoded protein plays an important role in immunosuppression and regulation of anti-tumor activity. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Versandbedingungen:
- Blue Ice