RP00124
Recombinant Human c-Kit ligand/KITLG/SCF Protein
Größe
£133.00
- SKU:
- RP00124
- Zusätzliche Namen:
- KITLG,DCUA,DFNA69,FPH2,FPHH,KL-1,Kitl,MGF,SCF,SF,SHEP7
- Molekulargewicht:
- 30-40 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Glu26-His214
- Formulierung:
- Recombinant Human c-Kit ligand/KITLG/SCF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu26-His214) of human SCF/C-kit ligand (Accession #NP_000890.1) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLH
- Uniprot:
- P21583
- Synonyme:
- c-Kit ligand;DCUA;DFNA69;familial progressive hyperpigmentation 2;FPH2;FPHH;kit ligand;Kitl;KL-1;mast cell growth factor;MGF;SCF;SF;SHEP7;SLF;steel factor;stem cell factor
- Weitere Details:
- The protein is tyrosine-kinase receptor. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis.
- Versandbedingungen:
- Blue Ice