Recombinant Human Lung surfactant protein D/SFTPD(E22G) Protein

Größe

£127.00

SKU:: RP00117
Zusätzliche Namen:: SFTPD,COLEC7,PSP-D,SFTP4,SP-D
Molekulargewicht:: 40-50 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Ala21-Phe375(E22G)
Formulierung:: Recombinant Human Lung surfactant protein D/SFTPD(E22G) Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ala21-Phe375 (Glu22Gly)) of human SFTPD/SP-D/SFTP4 (Accession #NP_003010.4) fused with a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: AEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
Uniprot:: P35247
Synonyme:: COLEC7;collectin-7;lung surfactant protein D;PSP-D;pulmonary surfactant apoprotein;pulmonary surfactant-associated protein D;SFTP4;SP-D;surfactant-associated protein, pulmonary 4
Weitere Details:: The protein encoded by this gene is part of the innate immune response, protecting the lungs against inhaled microorganisms and chemicals. The encoded protein may also be involved in surfactant metabolism.