RP00110
Recombinant Human Cystatin-C/CST3 Protein
Größe
£193.00
- SKU:
- RP00110
- Zusätzliche Namen:
- ARMD11, HEL-S-2,CST3,HEL-S-2
- Molekulargewicht:
- 15-25 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Met1-Ala146
- Formulierung:
- Recombinant Human Cystatin-C/CST3 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Met1-Ala146) of human Cystatin C/CST3 (Accession #NP_000090.1) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
- Uniprot:
- P01034
- Synonyme:
- ARMD11;bA218C14.4 (cystatin C);cystatin 3;Cystatin-3;cystatin-C;epididymis secretory protein Li 2;gamma-trace;HEL-S-2;neuroendocrine basic polypeptide;post-gamma-globulin
- Weitere Details:
- The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions.
- Versandbedingungen:
- Blue Ice