RP00109
Recombinant Human Clusterin/Apo-J/CLU Protein
Größe
£127.00
- SKU:
- RP00109
- Zusätzliche Namen:
- CLU,AAG4,APO-J,APOJ,CLI,CLU1,CLU2,KUB1,NA1/NA2,SGP-2,SGP2,SP-40,TRPM-2,TRPM2,clusterin,Clusterin alpha chain
- Molekulargewicht:
- 35-40 kDa
- Reinheit:
- ≥85%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Asp23-Arg227(B Betachain)&Ser228-Glu449(A Alphachain)
- Formulierung:
- Recombinant Human Clusterin/Apo-J/CLU Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Asp23-Arg227 (B Betachain)&Ser228-Glu449 (A Alphachain)) of human Clusterin/Apolipo J/Apo-J/CLU (Accession #NP_001822) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE
- Uniprot:
- P10909
- Synonyme:
- AAG4;Aging-associated gene 4 protein;aging-associated protein 4;APO-J;APOJ;apolipoprotein J;CLI;CLU1;CLU2;clusterin;complement cytolysis inhibitor;complement lysis inhibitor;complement-associated protein SP-40,40;epididymis secretory sperm binding protein;ku70-binding protein 1;KUB1;NA1/NA2;SGP-2;SGP2;SP-40;sulfated glycoprotein 2;testosterone-repressed prostate message 2;TRPM-2;TRPM2
- Weitere Details:
- The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.
- Versandbedingungen:
- Blue Ice