Recombinant Human Cystatin-SN/CST1 Protein

Größe

£193.00

SKU:: RP00100
Zusätzliche Namen:: CST1
Molekulargewicht:: Approximately 15 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Trp21-Ser141
Formulierung:: Recombinant Human Cystatin-SN/CST1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Trp21-Ser141) of human Cystatin SN/CST1 (Accession #NP_001889.2) fused with a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: WSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES
Uniprot:: P01037
Synonyme:: cystain-SA-I;cystatin 1;cystatin SA-I;Cystatin-1;cystatin-SN;cysteine proteinase inhibitor, type 2 family;salivary cystatin-SA-1
Weitere Details:: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a cysteine proteinase inhibitor found in saliva, tears, urine, and seminal fluid.

Versandbedingungen:: Blue Ice