RP00081
Recombinant Human Fc gamma RIIA/FCGR2A/CD32a (H167R) Protein
Größe
£113.05
War £133.00
- SKU:
- RP00081
- Zusätzliche Namen:
- FCGR2A,CD32,CD32A,CDw32,FCG2,FCGR2,FCGR2A1,FcGR,IGFR2
- Molekulargewicht:
- 25-35 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ala36-Ile218(H167R)
- Formulierung:
- Recombinant Human Fc gamma RIIA/FCGR2A/CD32a (H167R) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala36-Ile218 (R167)) of human Fc gamma RIIA/CD32a (Accession #NP_001129691.1) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGI
- Uniprot:
- P12318
- Synonyme:
- CD32;CD32A;CDw32;Fc fragment of IgG, low affinity IIa, receptor (CD32);Fc gamma receptor RIIa3;Fc-gamma RII-a;fc-gamma-RIIa;FCG2;FcGR;FCGR2;FCGR2A1;fcRII-a;IGFR2;igG Fc receptor II-a;Immunoglobulin G Fc receptor II;low affinity immunoglobulin gamma Fc region receptor II-a
- Weitere Details:
- The member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice