Recombinant Human Kallikrein-1/KLK1 Protein

Größe

Auf Anfrage

SKU:: RP00078
Zusätzliche Namen:: KLK1,KLKR,Klk6,hK1
Molekulargewicht:: 38-50 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Met1-Ser262
Formulierung:: Recombinant Human Kallikrein-1/KLK1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Met 1-Ser 262) of human Kallikrein 1 (Accession #NP_002248) fused with a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENS
Uniprot:: P06870
Synonyme:: glandular kallikrein 1;hK1;kallikrein 1, renal/pancreas/salivary;kallikrein serine protease 1;kallikrein-1;kidney/pancreas/salivary gland kallikrein;Klk6;KLKR;tissue kallikrein
Weitere Details:: This protein is the class A macrophage scavenger receptors, which include three different types (1, 2, 3) generated by alternative splicing of this gene. These receptors or isoforms are macrophage-specific trimeric integral membrane glycoproteins and have been implicated in many macrophage-associated physiological and pathological processes including atherosclerosis, Alzheimer's disease, and host defense. The isoforms type 1 and type 2 are functional receptors and are able to mediate the endocytosis of modified low density lipoproteins (LDLs). The isoform type 3 does not internalize modified LDL (acetyl-LDL) despite having the domain shown to mediate this function in the types 1 and 2 isoforms. It has an altered intracellular processing and is trapped within the endoplasmic reticulum, making it unable to perform endocytosis. The isoform type 3 can inhibit the function of isoforms type 1 and type 2 when co-expressed, indicating a dominant negative effect and suggesting a mechanism for regulation of scavenger receptor activity in macrophages.

Versandbedingungen:: Blue Ice