RP00075
Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein
Größe
£133.00
- SKU:
- RP00075
- Zusätzliche Namen:
- FCGR2B,CD32,CD32B,FCG2,FCGR2,IGFR2
- Molekulargewicht:
- 25-35 kDa
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥95 %
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ala46-Pro217
- Formulierung:
- Recombinant Human Fc gamma RIIB/FCGR2B/CD32b Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ala46-Pro217) of human Fc gamma RIIB/C (Accession #NP_003992.3) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP
- Uniprot:
- P31994
- Synonyme:
- CD32;CD32B;CDw32;Fc fragment of IgG, low affinity II, receptor for (CD32);Fc fragment of IgG, low affinity IIb, receptor (CD32);Fc fragment of IgG, low affinity IIb, receptor for (CD32);Fc gamma receptor IIb;Fc gamma RIIb;fc-gamma RII-b;Fc-gamma RII-c;fc-gamma-RIIb;Fc-gamma-RIIc;FCG2;FCGR2;FCGR2C;fcRII-b;FcRII-c;IGFR2;igG Fc receptor II-b;IgG Fc receptor II-c;low affinity immunoglobulin gamma Fc region receptor II-b;Low affinity immunoglobulin gamma Fc region receptor II-c
- Weitere Details:
- The protein is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells.
- Versandbedingungen:
- Blue Ice