Recombinant Human Ep-CAM/TROP-1/CD326 Protein

Größe

£133.00

SKU:: RP00073
Zusätzliche Namen:: DIAR5, EGP-2, EGP314, EGP40, ESA, HNPCC8, KS1/4, KSA, M4S1, MIC18, MK-1, TACSTD1, TROP1,EPCAM, DIAR5, epithelial cell adhesion molecule,EGP-2,EGP314,EGP40,ESA,HNPCC8,KS1/4,KSA,M4S1,MIC18,MK-1,TACSTD1,TROP1
Molekulargewicht:: 35-40 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Gln24-Lys265
Formulierung:: Recombinant Human Ep-CAM/TROP-1/CD326 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln24-Lys265) of human EpCAM/TROP-1 (Accession #NP_002345.2) fused with a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
Uniprot:: P16422
Synonyme:: adenocarcinoma-associated antigen;cell surface glycoprotein Trop-1;DIAR5;EGP-2;EGP314;EGP40;epithelial cell adhesion molecule;Epithelial cell surface antigen;Epithelial glycoprotein;epithelial glycoprotein 314;ESA;HNPCC8;human epithelial glycoprotein-2;KS 1/4 antigen;KS1/4;KSA;M4S1;major gastrointestinal tumor-associated protein GA733-2;membrane component, chromosome 4, surface marker (35kD glycoprotein);MIC18;MK-1;TACSTD1;TROP1;trophoblast cell surface antigen 1;tumor-associated calcium signal transducer 1
Weitere Details:: This protein is a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas.

Versandbedingungen:: Blue Ice