RP00071
Recombinant Human R-spondin-1/RSPO1 Protein
Größe
£145.00
- SKU:
- RP00071
- Zusätzliche Namen:
- RSPO1,CRISTIN3,RSPO
- Molekulargewicht:
- 39 kDa
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 90 %
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Arg31-Ala263
- Formulierung:
- Recombinant Human R-spondin-1/RSPO1 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Arg31-Ala263) of human R-Spondin1 (Accession #NP_001033722.1) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA
- Uniprot:
- Q2MKA7
- Synonyme:
- CRISTIN3;R-spondin homolog;R-spondin-1;roof plate-specific spondin-1;RSPO
- Weitere Details:
- This protein is a secreted activator protein with two cysteine-rich, furin-like domains and one thrombospondin type 1 domain. The encoded protein is a ligand for leucine-rich repeat-containing G-protein coupled receptors (LGR proteins) and positively regulates the Wnt signaling pathway. In mice, the protein induces the rapid onset of crypt cell proliferation and increases intestinal epithelial healing, providing a protective effect against chemotherapy-induced adverse effects.
- Versandbedingungen:
- Blue Ice