Recombinant Human Bcl-2 Protein

Größe

£145.00

SKU:: RP00062
Zusätzliche Namen:: BCL2, Bcl-2, PPP1R50, apoptosis regulator Bcl-2,Bcl-2,PPP1R50
Molekulargewicht:: 25-30 kDa
Reinheit:: ≥90%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Ala2-Asp211
Formulierung:: Recombinant Human Bcl-2 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala2-Asp211) of human BCL2 (Accession #NP_000624.2) fused with no tags.
Spezies:: Human
Sequenz:: AHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD
Uniprot:: P10415
Synonyme:: apoptosis regulator Bcl-2;B-cell CLL/lymphoma 2;Bcl-2;PPP1R50;protein phosphatase 1, regulatory subunit 50
Weitere Details:: This protein is an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma.