RP00060
Recombinant Human TNFSF9/4-1BB Ligand Protein
Größe
£133.00
- SKU:
- RP00060
- Zusätzliche Namen:
- 4-1BB-L, CD137L, TNLG5A,TNFSF9,CD137L,TNLG5A
- Molekulargewicht:
- 18-25 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Arg71-Glu254
- Formulierung:
- Recombinant Human TNFSF9/4-1BB Ligand Protein is produced by E. coli expression system. The target protein is expressed with sequence (Arg71-Glu254) of human 4-1BB Ligand/TNFSF9 (Accession #NP_003802.1) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
- Uniprot:
- P41273
- Synonyme:
- 4-1BB ligand;4-1BB-L;4-1BBL;CD137 ligand;CD137L;homolog of mouse 4-1BB-L;receptor 4-1BB ligand;TNLG5A;tumor necrosis factor (ligand) superfamily, member 9;tumor necrosis factor ligand 5A;tumor necrosis factor ligand superfamily member 9;tumor necrosis factor superfamily member 9
- Weitere Details:
- The protein is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molecule in T lymphocytes. This cytokine and its receptor are involved in the antigen presentation process and in the generation of cytotoxic T cells. The receptor TNFRSF9/4-1BB is absent from resting T lymphocytes but rapidly expressed upon antigenic stimulation. The ligand encoded by this gene, TNFSF9/4-1BBL, has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells. This cytokine is expressed in carcinoma cell lines, and is thought to be involved in T cell-tumor cell interaction.
- Versandbedingungen:
- Blue Ice