Recombinant Human TNFSF15/TL1 Protein

Größe

£145.00

SKU:: RP00053
Zusätzliche Namen:: TNFSF15,TL1,TL1A,TNLG1B,VEGI,VEGI192A
Molekulargewicht:: 21 kDa
Reinheit:: ≥90%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Leu72-Leu251
Formulierung:: Recombinant Human TNFSF15/TL1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Leu72-Leu251) of human TL1A/TNFSF15 (Accession #NP_005109.2) fused with an initial Met at the N-terminus.
Spezies:: Human
Sequenz:: LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Uniprot:: O95150
Synonyme:: TL1;TL1A;TNF ligand-related molecule 1;TNF superfamily ligand TL1A;TNLG1B;tumor necrosis factor (ligand) superfamily, member 15;tumor necrosis factor ligand 1B;tumor necrosis factor ligand superfamily member 15;tumor necrosis factor superfamily member 15;vascular endothelial cell growth inhibitor;vascular endothelial growth inhibitor-192A;VEGI;VEGI192A
Weitere Details:: The protein is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of this protein is inducible by TNF and IL-1 alpha. This cytokine is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6. It can activate NF-kappaB and MAP kinases, and acts as an autocrine factor to induce apoptosis in endothelial cells. This cytokine is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor.

Versandbedingungen:: Blue Ice