Recombinant Human FGF-21 Protein

Größe

£127.00

SKU:: RP00049
Zusätzliche Namen:: FGF21, fibroblast growth factor 21
Molekulargewicht:: 25 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: His29-Ser209
Formulierung:: Recombinant Human FGF-21 Protein is produced by E. coli expression system. The target protein is expressed with sequence (His29-Ser209) of human FGF-21 (Accession #NP_061986.1).
Spezies:: Human
Sequenz:: HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Uniprot:: Q9NSA1
Synonyme:: fibroblast growth factor 21
Weitere Details:: This protein is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. This protein is a secreted endocrine factor that functions as a major metabolic regulator. The protein stimulates the uptake of glucose in adipose tissue.