Recombinant Human HTRA2 Protein

Größe

£115.00

SKU:: RP00041
Zusätzliche Namen:: HTRA2,MGCA8,OMI,PARK13,PRSS25, OMI, PARK13, PRSS25
Molekulargewicht:: 35 kDa
Reinheit:: ≥90%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Ala134-Glu458
Formulierung:: Recombinant Human HTRA2 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala134-Glu458) of human HTRA2/Omi (Accession #NP_037379.1).
Spezies:: Human
Sequenz:: AVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE
Uniprot:: O43464
Synonyme:: epididymis secretory sperm binding protein;high temperature requirement protein A2;HtrA-like serine protease;MGCA8;OMI;Omi stress-regulated endoprotease;PARK13;protease, serine, 25;PRSS25;serine protease 25;serine protease HTRA2, mitochondrial;serine proteinase OMI
Weitere Details:: The protein is a serine protease. It has been localized in the endoplasmic reticulum and interacts with an alternatively spliced form of mitogen-activated protein kinase 14. The protein has also been localized to the mitochondria with release to the cytosol following apoptotic stimulus. The protein is thought to induce apoptosis by binding the apoptosis inhibitory protein baculoviral IAP repeat-containing 4. Nuclear localization of this protein has also been observed.

Versandbedingungen:: Blue Ice