Recombinant Human CNTF Protein

Größe

£145.00

SKU:: RP00039
Zusätzliche Namen:: CNTF,HCNTF
Molekulargewicht:: 25-35 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Met1-Met200
Formulierung:: Recombinant Human CNTF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Met200) of human CNTF (Accession #NP_000605.1) fused with a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
Uniprot:: P26441
Synonyme:: Ciliary Neuronotrophic Factor;ciliary neurotrophic factor;HCNTF
Weitere Details:: The protein is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this protein, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease.