Recombinant Human Sulfotransferase 1A1/SULT1A1 Protein

Größe

£193.00

SKU:: RP00037
Zusätzliche Namen:: SULT1A1,HAST1/HAST2,P-PST,PST,ST1A1,ST1A3,STP,STP1,TSPST1
Molekulargewicht:: 32 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Met1-Leu295
Formulierung:: Recombinant Human Sulfotransferase 1A1/SULT1A1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Leu295) of human SULT1A1 (Accession #NP_001046.2) fused with a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Uniprot:: P50225
Synonyme:: aryl sulfotransferase 1;HAST1/HAST2;P-PST;P-PST 1;Phenol sulfotransferase 1;phenol-sulfating phenol sulfotransferase 1;PST;ST1A1;ST1A3;STP;STP1;sulfotransferase 1A1;sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1;Thermostable phenol sulfotransferase;thermostable phenol sulfotransferase1;ts-PST;TSPST1
Weitere Details:: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds.Particularly SULT1A1 (Sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1), a member of the sulfotransferase 1 subfamily, which is a major pathway for drug metabolism in humans. Statistically significant associations were observed between the SULT1A1 genotype (Arg213His) and age, obesity and certain neoplasias (mammary, pulmonary, esophageal and urothelial cancer). Furthermore, the polymorphism of the SULT1A1 may be closely associated with breast cancer.

Versandbedingungen:: Blue Ice