RP00035
Recombinant Human IL-36 gamma/IL-1F9 Protein
Größe
£163.00
- SKU:
- RP00035
- Zusätzliche Namen:
- IL36G,IL-1F9,IL-1H1,IL-1RP2,IL1E,IL1F9,IL1H1,IL1RP2
- Molekulargewicht:
- 17 kDa
- Reinheit:
- ≥90%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ser18-Asp169
- Formulierung:
- Recombinant Human IL-36 gamma/IL-1F9 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser18-Asp169) of human Interleukin-36 gamma (Accession #NP_062564.1 ).
- Spezies:
- Human
- Sequenz:
- SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND
- Uniprot:
- Q9NZH8
- Synonyme:
- IL-1 related protein 2;IL-1-epsilon;IL-1-related protein 2;IL-1F9;IL-1H1;IL-1RP2;IL1E;IL1F9;IL1H1;IL1RP2;interleukin 1-related protein 2;interleukin-1 epsilon;interleukin-1 family member 9;interleukin-1 homolog 1;interleukin-36 gamma
- Weitere Details:
- The protein is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection.
- Versandbedingungen:
- Blue Ice