Recombinant Human IL-36Ra/IL-1F5 Protein

Größe

£145.00

SKU:: RP00030
Zusätzliche Namen:: IL36RN,FIL1,FIL1(DELTA),FIL1D,IL-36Ra,IL1F5,IL1HY1,IL1L1,IL1RP3,IL36RA,PSORP,PSORS14
Molekulargewicht:: 14-18 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Val2-Asp155
Formulierung:: Recombinant Human IL-36Ra/IL-1F5 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val2-Asp155) of human IL-36Ra (Accession #NP_036407.1) fused with a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
Uniprot:: Q9UBH0
Synonyme:: FIL1;FIL1 delta;FIL1(DELTA);FIL1D;IL-1 related protein 3;IL-1-related protein 3;IL-1F5 (IL-1HY1, FIL1-delta, IL-1RP3, IL-1L1, IL-1-delta);IL-1ra homolog 1;IL-36Ra;IL1F5;IL1F5 (Canonical product IL-1F5a);IL1HY1;IL1L1;IL1RP3;IL36RA;interleukin 1 family, member 5 (delta);Interleukin-1 delta;Interleukin-1 family member 5;interleukin-1 HY1;interleukin-1 receptor antagonist homolog 1;interleukin-1-like protein 1;interleukin-36 receptor antagonist protein;PSORP;PSORS14
Weitere Details:: Interleukin-1 family member 5 (IL-1F5), also known as interleukin 36 receptor antagonist (IL36RA), is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). IL-1F5 is a highly and a specific antagonist of the IL-1 receptor-related protein 2-mediated response to interleukin 1 family member 9 (IL1F9). IL-1F5 could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist and interleukin-1 receptor type I (IL-1R1), which is present in epithelial barriers and takes part in local inflammatory response. It has been proved that IL-1F5 induces IL-4 mRNA and protein expression in glia in vitro and enhances hippocampal expression of IL-4 following intracerebroventricular injection. The inhibitory effect of IL-1F5 on LPS-induced IL-1B Beta is attenuated in cells from IL-4-defective mice.

Versandbedingungen:: Blue Ice