RP00027
Recombinant Human IL-36 alpha/IL-1F6 Protein
Größe
£133.00
- SKU:
- RP00027
- Zusätzliche Namen:
- IL36A,FIL1,FIL1(EPSILON),FIL1E,IL-1F6,IL1(EPSILON),IL1F6
- Molekulargewicht:
- 14-18 kDa
- Reinheit:
- ≥95%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Met1-Phe158
- Formulierung:
- Recombinant Human IL-36 alpha/IL-1F6 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Phe158) of human IL-36 alpha (Accession #NP_055255.1) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
- Uniprot:
- Q9UHA7
- Synonyme:
- FIL1;FIL1 epsilon;FIL1(EPSILON);FIL1E;IL-1 epsilon;IL-1F6;IL-1F6 (FIL-1-epsilon);IL1(EPSILON);IL1F6;interleukin 1 family, member 6 (epsilon);interleukin-1 epsilon;interleukin-1 family member 6;interleukin-36 alpha
- Weitere Details:
- Interleukin-1 family member 6 (IL-1F6), also known as interleukin 36, alpha (IL36A), is a pro-inflammatory cytokine which plays an important role in innate and adaptive immunity.IL-1F6 can activate NF-kappa-B and MAPK signaling pathways to generate an inflammatory response. The encoded protein functions primarily in skin and demonstrates increased expression in psoriasis. In addition, decreased expression of this protein has been linked to a poor prognosis in both hepatocellular carcinoma and colorectal cancer patients.
- Versandbedingungen:
- Blue Ice