RP00020
Recombinant Human IL-36 beta/IL-1F8 Protein
Größe
£163.00
- SKU:
- RP00020
- Zusätzliche Namen:
- FIL1,FIL1-(ETA),FIL1H,FILI-(ETA),IL-1F8,IL-1H2,IL1-ETA,IL1F8,IL1H2,IL36B
- Molekulargewicht:
- 18-25 kDa
- Reinheit:
- ≥90%
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Arg5-Glu157
- Formulierung:
- Recombinant Human IL-36 beta/IL-1F8 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Arg5-Glu157) of human IL-36 beta (Accession #NP_775270.1) fused with a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- REAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE
- Uniprot:
- Q9NZH7
- Synonyme:
- family of interleukin 1-eta;FIL1;FIL1 eta;FIL1-(ETA);FIL1H;FILI-(ETA);IL-1 eta;IL-1F8;IL-1F8 (FIL1-eta);IL-1H2;IL1-ETA;IL1F8;IL1F8 (Canonical product IL-1F8a);IL1H2;interleukin 1 family, member 8 (eta);interleukin-1 eta;interleukin-1 family member 8;interleukin-1 homolog 2;Interleukin-1 Superfamily e;interleukin-36 beta
- Weitere Details:
- Interleukin-1 family member 8(IL1F8) also known as IL36B, is a member of the interleukin 1(IL-1) cytokine family. IL-36 beta is expressed by keratinocytes, naive CD4+ T cells, neurons, and glia. It is up-regulated in keratinocytes and synovial fibroblasts by inflammatory stimulation and in psoriatic lesions. IL-36 beta promotes inflammatory responses by enhancing the activation and Th1 polarization of dendritic cells and T cells. It also enhances the production of multiple pro-inflammatory cytokines, chemokines, and anti-bacterial defensin peptides by keratinocytes, synovial fibroblasts, and articular chondrocytes. IL-1 family members exert their effects through binding to receptors that belong to the IL-1 receptor (IL-1R) family.
- Versandbedingungen:
- Blue Ice