Recombinant Human IL-33 Protein

Größe

£163.00

SKU:: RP00019
Zusätzliche Namen:: IL33,C9orf26,DVS27,IL1F11,NF-HEV,NFEHEV
Molekulargewicht:: 19 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Ser112-Thr270
Formulierung:: Recombinant Human IL-33 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser112-Thr270) of human IL-33 (Accession #NP_001300973.1).
Spezies:: Human
Sequenz:: SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
Uniprot:: O95760
Synonyme:: C9orf26;DVS27;DVS27-related protein;IL1F11;interleukin-1 family member 11;interleukin-33;NF-HEV;NFEHEV;nuclear factor for high endothelial venules;nuclear factor from high endothelial venules
Weitere Details:: Interleukin 33 (IL-33), also known as DVS27 or NF-HEV (Nuclear Factor from High Endothelial enules), is a proinflammatory protein and a chromatin-associated cytokine of the IL-1 family with high sequence and structural similarity to IL-1 and IL-18. The encoded protein is involved in the maturation of Th2 cells and the activation of mast cells, basophils, eosinophils and natural killer cells.