Recombinant Human PIN1 Protein

Größe

£133.00

SKU:: RP00015
Zusätzliche Namen:: PIN1,DOD,UBL5
Molekulargewicht:: 18 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Met1-Glu163
Formulierung:: Recombinant Human PIN1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Glu163) of human PIN1 (Accession #NP_006212.1).
Spezies:: Human
Sequenz:: MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Uniprot:: Q13526
Synonyme:: DOD;peptidyl-prolyl cis-trans isomerase NIMA-interacting 1;Peptidyl-prolyl cis-trans isomerase Pin1;PPIase Pin1;protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1;protein interacting with never in mitosis A1;rotamase Pin1;UBL5
Weitere Details:: Peptidyl-prolyl cis/trans isomerases (PPIases) catalyze the cis/trans isomerization of peptidyl-prolyl peptide bonds. This protein is a nucleus protein which specifically binds to phosphorylated ser/thr-pro motifs to catalytically regulate the post-phosphorylation conformation of its substrates. The conformational regulation catalyzed by this PPIase has a profound impact on key proteins involved in the regulation of cell growth, genotoxic and other stress responses, the immune response, induction and maintenance of pluripotency, germ cell development, neuronal differentiation, and survival. This enzyme also plays a key role in the pathogenesis of Alzheimer's disease and many cancers.

Versandbedingungen:: Blue Ice