Recombinant Human UBE2D3 Protein

Größe

£107.00

SKU:: RP00012
Zusätzliche Namen:: UBE2D3,E2(17)KB3,UBC4/5,UBCH5C
Molekulargewicht:: 14-18 kDa
Reinheit:: ≥95%
Lagerbedingungen:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Immunogen:: Met1-Met147
Formulierung:: Recombinant Human UBE2D3 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Met147) of human UBE2D3 (Accession #NP_003331.1) fused with a 6xHis tag at the C-terminus.
Spezies:: Human
Sequenz:: MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM
Uniprot:: P61077
Synonyme:: (E3-independent) E2 ubiquitin-conjugating enzyme D3;E2 ubiquitin-conjugating enzyme D3;E2(17)KB3;UBC4/5;UBCH5C;ubiquitin carrier protein D3;ubiquitin conjugating enzyme E2D 3;ubiquitin-conjugating enzyme E2 D3;ubiquitin-conjugating enzyme E2-17 kDa 3;ubiquitin-conjugating enzyme E2(17)KB 3;ubiquitin-conjugating enzyme E2D 3 (homologous to yeast UBC4/5);ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast);ubiquitin-protein ligase D3
Weitere Details:: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase.

Versandbedingungen:: Blue Ice