RP00002
Recombinant Human IL-1 beta Protein
Größe
£145.00
- SKU:
- RP00002
- Zusätzliche Namen:
- IL-1,IL1-BETA,IL1F2,IL1 beta,IL1B
- Molekulargewicht:
- 18 kDa
- Reinheit:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Lagerbedingungen:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Immunogen:
- Ala117-Ser269
- Formulierung:
- Recombinant Human IL-1 beta Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala117-Ser269) of human IL-1 beta (Accession #NP_000567.1) fused with an initial Met at the N-terminus and a 6xHis tag at the C-terminus.
- Spezies:
- Human
- Sequenz:
- APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
- Uniprot:
- P01584
- Synonyme:
- catabolin;IL-1;IL-1 beta;IL1-BETA;IL1beta;IL1F2;interleukin 1beta;interleukin-1 beta;preinterleukin 1 beta;pro-interleukin-1-beta
- Weitere Details:
- Interleukin-1 beta (IL1 beta or IL1B) also known as catabolin, is a member of the interleukin 1 cytokine family.This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity.
- Versandbedingungen:
- Blue Ice