SLC2A13 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A9993
Zusätzliche Namen:: HMIT|SLC2A13
Anwendung:: ELISA, WB
Molekulargewicht:: 73kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LHTAEYLTYYGAFFLYAGFAAVGLLFIYGCLPETKGKKLEEIESLFDNRLCTCGTSDSDEGRYIEYIRVKGSNYHLSDNDASDVE
Uniprot:: Q96QE2
Synonyme:: h(+)-myo-inositol cotransporter;H(+)-myo-inositol symporter;HMIT;proton (H+) myo-inositol symporter;proton myo-inositol cotransporter;solute carrier family 2 (facilitated glucose transporter), member 13;Solute carrier family 2 member 13
Weitere Details:: Enables ATPase binding activity; myo-inositol:proton symporter activity; and protease binding activity. Involved in myo-inositol transport and positive regulation of amyloid-beta formation. Is integral component of plasma membrane. Part of cell body; cell periphery; and cell projection.