UQCC2 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A9986
Zusätzliche Namen:: bA6B20.2|C6orf125|C6orf126|Cbp6|M19|MC3DN7|MNF1|UQCC2
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 15kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EEWPVDETKRGRDLGAYLRQRVAQAFREGENTQVAEPEACDQMYESLARLHSNYYKHKYPRPRDTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGPEEDHKA
Uniprot:: Q9BRT2
Synonyme:: bA6B20.2;breast cancer-associated protein SGA-81M;C6orf125;C6orf126;Cbp6;cytochrome B protein synthesis 6 homolog;M19;MC3DN7;mitochondrial nucleoid factor 1;mitochondrial protein M19;MNF1;ubiquinol-cytochrome-c reductase complex assembly factor 2
Weitere Details:: This gene encodes a nucleoid protein localized to the mitochondria inner membrane. The encoded protein affects regulation of insulin secretion, mitochondrial ATP production, and myogenesis through modulation of mitochondrial respiratory chain activity.