CHRNA9 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A9975
Zusätzliche Namen:: CHRNA9|HSA243342|NACHRA9
Anwendung:: ELISA, WB
Molekulargewicht:: 75kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ADGKYAQKLFNDLFEDYSNALRPVEDTDKVLNVTLQITLSQIKDMDERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDIFNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRSSFY
Uniprot:: Q9UGM1
Synonyme:: acetylcholine receptor, neuronal nicotinic, alpha-9 subunit;cholinergic receptor, nicotinic alpha 9;cholinergic receptor, nicotinic, alpha 9 (neuronal);cholinergic receptor, nicotinic, alpha polypeptide 9;HSA243342;NACHR alpha 9;NACHRA9;neuronal acetylcholine receptor protein, alpha-9 subunit;neuronal acetylcholine receptor subunit alpha-9;nicotinic acetylcholine receptor subunit alpha 9;Nicotinic acetylcholine receptor subunit alpha-9
Weitere Details:: This gene is a member of the ligand-gated ionic channel family and nicotinic acetylcholine receptor gene superfamily. It encodes a plasma membrane protein that forms homo- or hetero-oligomeric divalent cation channels. This protein is involved in cochlea hair cell development and is also expressed in the outer hair cells (OHCs) of the adult cochlea.

Versandbedingungen:: Blue Ice